PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 428906
Common NamePRR1, SELMODRAFT_428906
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family ARR-B
Protein Properties Length: 593aa    MW: 65235.6 Da    PI: 4.5917
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
428906genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.64.8e-27350404156
  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
              k +++WtpeLH++Fv+aveqL G +kA+P++ile+m+vk+Lt+++++SHLQkYR++
   428906 350 KMKVDWTPELHQKFVQAVEQL-GVDKAIPSRILEHMGVKCLTRHNIASHLQKYRSH 404
              5689*****************.********************************86 PP

2Response_reg39.92.2e-142812411109
                   HHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTT.SEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--H CS
  Response_reg  11 rellrqalekegyeevaeaddgeealellkekd..pDlillDiempg.mdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdp 104
                   re +  +l++  y +v+++++ e+al+ +++ +  ++  ++D    +  dG+++l+  +e    l +i+++++++ e++ +a+++Ga dfl Kpf++
        428906  28 REEISGILQSCSY-RVTAFTSEEDALAAIEKPKtpFHAAMVDATNRDiFDGFKVLEAAKE----LAVIMISSTEDIETMMRAISLGAADFLQKPFSE 119
                   677888999999*.***************877778*******998887799988876555....77******************************* PP

                   HHHHH CS
  Response_reg 105 eelvk 109
                   e+l +
        428906 120 EKLKN 124
                   **986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.01E-1814138IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23005.0E-2015141No hitNo description
PROSITE profilePS5011023.90117130IPR001789Signal transduction response regulator, receiver domain
SMARTSM004482.5E-918126IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.25E-1226130No hitNo description
PfamPF000728.8E-1028124IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5129417.408347406IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-26348407IPR009057Homeodomain-like
SuperFamilySSF466892.87E-18349407IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-25350404IPR006447Myb domain, plants
PfamPF002491.9E-8353402IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MPQDKLHGWK DFPKGLHVLV AIADGDDREE ISGILQSCSY RVTAFTSEED ALAAIEKPKT  60
PFHAAMVDAT NRDIFDGFKV LEAAKELAVI MISSTEDIET MMRAISLGAA DFLQKPFSEE  120
KLKNIWQHVA RKAMLSTNSE PASTVADHEV KPETLDDGDQ IESQMQSFDD LGCIIGESFH  180
ECEKFPEVEE PAATETKEGF DVNGKLYDLE REFMRSTNLE FCTAEGTCIK LEIDDTLDDL  240
NLGDGIVLDG EGATEFELDP SLFVGFPDSD SDSALDINFE MLDSGDTHES EFDGEEAMML  300
AQVLKTEDEV VRNVSESSES MSSSTKEKGE EETKPERAAK SCKSAPGRKK MKVDWTPELH  360
QKFVQAVEQL GVDKAIPSRI LEHMGVKCLT RHNIASHLQK YRSHRKHLLQ REAEAAVNWS  420
HRRHSDTWSK NRAPTQSRQT PILPAPPPGG VPLLVWGHPT IDHSSAHMWQ QQQPPVTPPP  480
WQAPDGTLWQ HPAVCFPPWG HAPAPGTPVY PNCMRVPVAP VIAVPQPPAP PLPGETLSPP  540
ACHPPREVVD AVISEALTNP CTLPLGLKPP SMESVMSELV KQGITITPPT PS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-14347402257ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002990416.10.0pseudo response regulator
TrEMBLD8T4E00.0D8T4E0_SELML; Pseudo response regulator
STRINGEFJ085090.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28401529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.14e-37GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]